<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7043 7043-30925 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M N88ND L10I, T12P, I15V, L19I, K20KT, K45R, I62V, L63P, C67CY, A71T, I72IM, V77I, I93L  
>7043-30925| codons 1-99
PQITLWQRPIVPIKVGGQITEALLDTGADDTVLEEMNLPGRWKPRMIGGIGGFIKVRQYD
QVPIEIYGHKTMGTVLIGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, T215SY K219N, N348I K103N, Y181C   T39A, K49R, K122E, I135T, E169D, Q174R, G196E, I202V, Q207E, H208HY, R211K, A272P, A288S, I293V, I309IL, K311KR, G333E, Q334HY, G359S, T386TI, K390R, E399G  
>7043-30925| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKRNPDIVI
CQYMDDLYVGSDLEIEQHRTKVEELREYLLKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LELAENRELLREPVHGVYYDPSKDLIAEIQKQEYGQWTYQIYQEPFKILKTGKYARMRSA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWGA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006