<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7035 7035-30812 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I L10I, T12P, L19T, K20I, M36I, L63P, A71T  
>7035-30812| codons 1-99
PQITLWQRPIVPIKIGGQTIEALIDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKTIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T215Y       T39TA, K122E, I135T, I142V, S162Y, A272P, T286A, A288AT, V292VI, I293IV, K311R, M357MT, E370D, T377TI, E399D  
>7035-30812| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTEIVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTDAVQKIAIESIVIWGKTPKFKLPIQKETWDA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006