<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7019 7019-30724 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, E35D, F53FY, L63P, A71V, V77I  
>7019-30724| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGYIKVRQYD
QIPIEICGHKVISTVLIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K43KN, E44D, V60VI, V118I, K122E, I142V, S162A, E203K, H208Y, R211K, A272P, T286TA, E297EK, Q334E, A371V, I375V, V381VI, K390R K223S
>7019-30724| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIKELRQYLWKWGFYTPDKKHQSEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEVVQKVATESIIIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006