<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7004 7004-30805 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L23I, L24I, F53L L10I, I15L, L19V, R41K, K55R, L63P, A71I, T74S, V77I  
>7004-30805| codons 1-99
PQITLWQRPIVTIKLGGQVKEAIIDTGADDTVLEEMNLPGKWKPKLIGGIGGLVRVRQYD
QIPIEICGHKIIGSVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q G190A A98G I135T, K173Q, F214L, K249Q, I293V, P294Q, E297K, K311R, A360T, A376T, K390R  
>7004-30805| codons 2-399
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVF
AIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPDIVIY
QYMDDLYVASDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWTV
QPIVLPEQDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVQLTKEAEL
ELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGTH
TNDVKQLTEAVQKITTESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006