<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7002 7002-30703 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75L, K219R K103N, Y188*L A98G K20R, V35L, K122KE, I135T, R172K, V179I, T200TA, I202V, E203D, Q207K, R211A, K223T, L228H, A272S, I293V, P294Q, K311R, V317A, G333E, M357Q, G359S, K366R, T386I  
>7002-30703| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLLDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIII
YQYVDDLLVGSDLEIGQHRAKVDELRKHLWAWGFYTPDRKHQTEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVVQLTEEAE
LELAENREILREPVHGAYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARQRSA
HTNDVRQLTEAVQKIATESIVIWGKIPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48A, I54V, V82A, L90M L33LI L10I, K20R, E35D, M36I, N37D, D60E, I62V, L63P, A71V, I85V, I93L  
>7002-30703| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVIEDIDLPGRWKPKLIAGIGGFVKVRQYE
QVPIEICGHKVIGTVLVGPTPANIVGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006