<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6362 6362-30929 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215TI, K219Q, N348IT K103N Y318F K104KT, D123E, I135T, G196E, T200Q, I202V, A272P, K277R, I293V, K311R, Q334D, G335C, R356K, M357K, K390R T165IM
>6362-30929| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNTSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMMKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRQKVEELRQHLLRWGFITPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILREPVHGVFYDPSKDLIAEIQKQGDCQWTYQIYQEPFKTLKTGKYAKKRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82A   T12P, I15V, L19T, N37S, K55R, I62V, L63P, I72M, V77I, I93L, C95F  
>6362-30929| codons 1-99
PQITLWQRPLVPIKVGGQTKEALLDTGADDTILEEMSLPGRWKPKIVGGIGGFIRVRQYD
QVPIEICGHKAMGTVLIGPTPANIIGRNLLTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006