<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6357 6357-30926 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, L210W, T215Y     A98G P4S, K20R, W88S, K101Q, V118I, K122E, K173T, G196E, R211K, L228H, V245M, E248D, A272P, K275R, I293V, P294T, Q334E, R358K, G359S, Q367L, I375V, T386I, K390R  
>6357-30926| codons 1-400
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSGKWRKLVDFRELNKRTQDFSEVQLGIPHPGGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIMLPDKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGTKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMKSA
HTNDVKLLTEAVQKVATESIVIWGKIPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M K43T L10I, T12S, I13V, L19P, K20I, E35D, M36I, Q61HN, I62V, L63P, I64IV, I66ILM, H69R, T74S, I93L, C95F  
>6357-30926| codons 1-99
PQITLWQRPIVSVKIGGQPIEALLDTGADDTVLEDINLPGRWTPKMIVGIGGFVKVRQYD
NVPVEMCGRKAIGSVLVGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006