<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6356 6356-30925 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82CST L24I, F53L, Q58E L10I, N37D, D60E, Q61N, L63P, I64V, A71V, T74S, V77I, I93L L38L_DL
>6356-30925| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMDLPGRWKPKIIGGIGGLVKVREYE
NIPVEICGHKVIGSVLIGPTPTNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y   Y188L   T39A, E44D, W88C, V106I, D123E, D177E, V179I, T200E, E203K, H208Y, R211K, K223E, D237E, A272S, T286A, E297K, Q334N, G335GS, K347KE, K350KR, R358RK, G359S, A371V, V372L, I375V, T386I  
>6356-30925| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
YQYMDDLLVGSDLEIGQHREKIKELRQYLWKWGFYTPDKKHQEEPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNSQWTYQIYQEPFENLRTGKYARMKSA
HTNDVKQLTEVLQKVATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006