<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6318 6318-30925 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V, L90M L10F, L33I, Q58E T12AE, I13V, L19P, K20I, E35D, M36I, L63P, I64V, A71V, L89I, T91S, I93L P79R
>6318-30925| codons 1-99
PQITLWQRPFVEVKIGGQPIEALLDTGADDTVIEDINLPGRWKPKLIGGIGGFIKVREYD
QIPVEICGHKVIGTVLVGRTPVNVIGRNIMSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q   A98G K122E, I135V, I142IV, Q174E, Q207E, V245K, I293V, E312EDKN, I329V, G333E, Q334L, M357MT, A371V, T377R, K390R, E399D  
>6318-30925| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEVQKQELGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEVVQKIARESIVIWGKTPKFRLPIQKETWDA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006