<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6314 6314-30917 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67NT, K70R, M184V T215I, K219E, N348I Y181I V108VI V60I, T69N, K122KE, I142V, D177E, V179I, G196E, T200A, F214L, E224D, V245T, K277KR, R284RK, T286A, I293V, M357T, A376S, T377TR, T386I, K390R, A400AT  
>6314-30917| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKTSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
IQYVDDLYVGSDLEIEQHRAKIEELRQHLLRWGLITPDEKHQKDPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARTRGA
HTNDVKQLTEAVQKISRESIVIWGKIPKFRLPIQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, G48V, I50V, I54T, V82A Q58E L10V, I15V, G16A, K20R, E34A, E35D, M36I, L63P, A71V, I93L  
>6314-30917| codons 1-99
PQITLWQRPVVTIKVAGQLREALLDTGADDTVLADINLPGRWKPKIIVGVGGFTKVREYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006