<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6308 6308-30924 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M Q58E, N88D L10I, I15V, G16A, K20R, E35D, M36I, N37ND, R57K, I62V, L63P, A71V, T91S  
>6308-30924| codons 1-99
PQITLWQRPIVTIKVAGQLREALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFVKVKEYD
QVPIEICGHKVIGTVLVGPTPANIIGRDLMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215CY     A98G S68G, K122E, V179I, R211K, K249Q, A272P, K281R, T286A, E297K, Q334E, V381I, T386TI, K390KR, E396D  
>6308-30924| codons 2-399
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVF
AIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLD
EDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIIIY
QYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEQDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTKEAEL
ELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRGAH
TNDVKQLTEAVQKIATESIIIWGKIPKFRLPIQKDTWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006