<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6306 6306-30918 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L33I L10V, I13V, K20I, M36I, P39S, D60E, I64V, A71V, V75I, I93L  
>6306-30918| codons 1-99
PQITLWQRPVVTVKIGGQLIEALLDTGADDTVIEEINLSGRWKPKMIGGIGGFVKVRQYE
QILVEICGHKVIGTILVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   G190A K101H K49R, R83K, I135T, S162A, E169D, V179I, G196E, E203D, V245E, A272P, K277R, T286P, I293V, E297A, I326V, I329V, Q334E, R356K, S379C  
>6306-30918| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILDPFRKQNPDIII
YQYVDDLYVASDLEIEQHRTKIDELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGPKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAEVQKQGEGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQKIATECIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006