<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6293 6293-30910 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M F53L, G73T L10V, T12K, I15V, G16E, L19P, K20I, E34Q, M36I, K45KR, Q61H, L63S, H69K  
>6293-30910| codons 1-99
PQITLWQRPVVKIKVEGQPIEALLDTGADDTVLQEINLPGRWKPRLIGGIGGLVKVRQYD
HISIEICGKKAITTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, Q151M, M184V T215I, K219Q   V108I K22R, V35T, V60I, W88CS, D123E, I135L, I178L, V179VI, I202IV, R211RT, F214L, A272P, K281R, E297R, I329V, V365I, T386I  
>6293-30910| codons 1-399
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFSEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDLII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLTWGLITPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDIKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006