<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6288 6288-30924 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L33LF, L89V I13V, K20R, E35ED, M36I, N37D, I62V, L63P, A71IV, I72V  
>6288-30924| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTIFEDIDLPGRWKPKIVGGIGGFMKVRQYD
QVPIEICGHKVVGTVLVGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006