<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6278 6278-30826 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, L90M M46V L10I, I15V, I62V, L63P, I64M  
>6278-30826| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKVIVGIGGFVKVRQYD
QVPMEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67G, K219Q     K20R, V60I, S68G, D123EG, I135L, D177E, I178L, G196E, A272P, K281R, T286A, V292I, E297K, G333E, Q334H, A360T, K390R  
>6278-30826| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKGFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEIIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEHGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006