<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6275 6275-30923 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V, L90M   L10I, T12K, I15V, G16GA, L19I, I62V, L63P, A71V, P79D, I93L  
>6275-30923| codons 1-99
PQITLWQRPIVKIKVAGQIKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVIGTVVVGDTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_SS, M184I, L210W, T215Y A62V     V35M, T39TA, V118I, K122E, I135T, Q207E, R211K, L228H, A272P, T286N, Q334N, R356K, A360T, K390R K43KHNQ
>6275-30923| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEQEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGNKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNGQWTYQIYQEPFKNLKTGKYAKMRGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006