<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6265 6265-30806 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F L33F, Q58E L10IV, E35D, M36I, N37S, R41K, R57K, Q61E, I62V, L63P, L89M  
>6265-30806| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVFEDISLPGKWKPKMIGGIGGFVKVKEYD
EVPIEICGHKAIGTVLVGPTPFNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y V75L K101E, G190S   T39TA, K43E, E44A, V106I, V118I, D123E, V179VG, G196E, R211K, A272P, K281R, E291D, P294S, E297K, I326V, Q334E, R356K, T369V, A376T  
>6265-30806| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLEKKKSITVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIGI
YQYMDDLYVSSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTDVISLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGEGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLVEAVQKITTESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006