<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6262 6262-30828 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L10F, L33F T12P, I15V, G17E, Q18H, K20T, E35D, M36I, N37P, I62V, L63P, I66L, C67F, A71T, I72T, I93L  
>6262-30828| codons 1-99
PQITLWQRPFVPIKVGEHLTEALLDTGADDTVFEDIPLPGRWKPKMIGGIGGFVKVRQYD
QVPIELFGHKTTGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y N348I K103N   V35M, T39A, K43E, V60I, V118I, I135T, S162W, D177DN, G196GE, T200A, R211K, L228LH, A272P, F346Y, M357T, D364DE  
>6262-30828| codons 1-398
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQWSMTKILEPFRKQNPNIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKILKTGKYARTRGA
HTNEVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETW

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006