<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6261 6261-30806 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82A L10F, K43T L63P, I64V, A71V, I93L  
>6261-30806| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTILEEMNLPGRWTPKIVGGIGGFLKVRQYD
QIPVEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67DG, K219Q Y188L   V35M, S48T, T69N, K122E, D123KN, I135V, F214L, D237N, V245VI, I293V, D324E, R356K, A360T, A371V, Q373H Y354YC
>6261-30806| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKITKIGPENPYNTPV
FAIKKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKHQKEPPFLWMGYELHPNKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKCAKMRGT
HTNDVKQLTEVVHKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006