<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6241 6241-30729 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N K43T, N88D E35D, M36I, R57K, L63P, A71V, V77I, I93L  
>6241-30729| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEDINLPGRWTPKMIGGIGGFIKVKQYD
QIPIEICGHKVIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     T39TA, V60I, T69N, V118I, D123E, Q174K, I178IM, V179VI, Q207E, R211K, F214L, L228H, A272P, K281KR, T286P, I293V, E297K, K311KR, S322T, D324E, Q334L, M357T  
>6241-30729| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDMII
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGPKALTEVVPLTKEAE
LELAENREILREPVHGVYYDPTKELIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006