<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6239 6239-30729 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_CT, L74V, L210W, T215Y D67S K101P   K20R, K43E, E44A, R83K, A98S, K102Q, V118I, K122E, D123E, I135T, S162D, K166R, I178M, G196E, T200A, R211K, V245E, A272P, E297K, R356RK, K366KR, A376V, T386A, K390KR  
>6239-30729| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKSSTKWRKVVDFRELNKKTQDFWEVQLGIPHPSGLPQKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTRILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVRQLTEAVQKIVTESIVIWGKAPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82A, L90M F53L, G73GS L10I, I15V, M36L, N37D, L38W, I62V, L63P, A71V  
>6239-30729| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEELDWPGRWKPKIIGGIGGLVKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006