<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6238 6238-30729 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A, L90M L10F, G73S I15V, K20I, E35D, M36I, N37E, L63P, C67F, A71V  
>6238-30729| codons 1-99
PQITLWQRPFVTIKVGGQLIEALLDTGADDTVLEDIELPGRWKPKIIGGVGGFVKVRQYD
QIPIEIFGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SG, L210W, T215Y A62V Y181I   P4S, K20KR, K101Q, K122KE, D123DE, I135T, V179I, E203K, R211K, L228H, A272P, T286P, E297R, V317A, Q334L, M357S, A360V, A376T  
>6238-30729| codons 1-399
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
IQYMDDLYVGSDLEIGQHRTKIKELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGPKALTEVIPLTREAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARSRGV
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006