<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6229 6229-30808 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG T215C     V35I, S48E, R83K, D123E, I135V, D177E, I178L, V179I, Q207E, V245K, A272P, R284K, T286A, E297K, Q334E, M357T, A360AT, T377R, K395R  
>6229-30808| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKIEKIGPENPYNTPV
FAIKKKDSGKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELII
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARTRGT
HTNDVKQLTEAVQKIARESIVIWGKTPKFKLPIQRETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54S, V82A   L10I, I13V, K20I, M36I, R41K, A71V  
>6229-30808| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIMGIGGFSKVRQYD
QILIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006