<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6225 6225-30729 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L10FIV, V11I, K43T, G73S T4S, T12S, I13IV, I15V, L19P, K20I, M36I, N37ND, D60E, I62V, L63P, A71I, I72R, I93L  
>6225-30729| codons 1-99
PQISLWQRPVISVKVGGQPIEALLDTGADDTVLEEIDLPGRWTPKIIGGIGGFVKVRQYE
QVPIEICGHKIRSTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67~, K70R, L74I, M184V, T215F T69G, K219E K103N V108I K20R, K43KQ, A98S, K122E, I135T, I167IV, L228H, V245E, A272P, K277R, R284K, T286A, V292I, I293V, Q334N, M357T, G359S, A360T, K366R, A376S, A400S  
>6225-30729| codons 2-400
ISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEQEGKISKIGPENPYNTPVF
AIKKK~SGRWRKIVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTILDVGDAYFSVPLD
EDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIVIY
QYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDEKHQKEPPFHWMGYELHPDKWTV
QPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLKGAKALTEIVPLTEEAEL
ELAENREILKEPVHGVYYDPSKDLIAEIQKQGNGQWTYQIYQEPFKNLKTGKYARTRSTH
TNDVRQLTEAVQKISTESIVIWGKTPKFKLPIQKETWES

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006