<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6223 6223-30730 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73A L10I, L63P, C67CF, I72L, V77I, I93L  
>6223-30730| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEIFGHKALATVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y N348I K103N V108I K20KR, V21I, R83K, D177DG, Q207E, R211K, A272P, L283I, E297A, Q334R, G335D, G359S, A371V, A376T, T386A  
>6223-30730| codons 1-399
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGRDQWTYQIYQEPFKILKTGKYARMRSA
HTNDVKQLTEVVQKITTESIVIWGKAPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006