<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6222 6222-30730 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46MI, I47IATV, L90LM   I62IV, L63LP, I64V, A71AV  
>6222-30730| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEEMNLPGRWKPKIVGGIGGFIKVRQYD
QVPVEICGHKVIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       E6D, V21I, K43E, V60I, K101Q, V118I, K122KE, D192DN, Q207E, L228H, V245T, R284K, T286A, A288T, I293V, M357T, K390R  
>6222-30730| codons 1-400
PISPIDTVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSNLEIGQHRTKIEELREHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKTLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006