<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6220 6220-30730 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, M184V D67G, K219Q K101E   K20R, T39A, V60I, S68G, D123E, I135T, E138A, G196E, F214L, A272P, T286A, E297R, I326V, G335S, M357T, A371V, I375V, T386V, E399D  
>6220-30730| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPI
FAIKKKGGDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQSQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEVVQKVATESIVIWGKVPKFKLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L10F, V11VI, G73S T12TS, I13V, L19I, K20I, K43KR, I62V, L63P, A71V  
>6220-30730| codons 1-99
PQITLWQRPFISVKIGGQIIEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006