<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6212 6212-30904 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54S, V82A, I84IV, L90LM L33F, K43T, T74P L10I, I13V, K20R, E34Q, M36I, I62V, L63P, H69K, A71V, I93M  
>6212-30904| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVFQEINLPGRWTPKIIVGIGGFSKVRQYD
QVPIEICGKKVIGPVLVGPTPANVIGRNLMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, Y115F, Q151M, M184V F116Y, K219Q, N348NI     T27S, E53D, D123E, S162N, F214L, L228LH, V245E, A272P, K277R, K281R, I293V, E297K, M357T, A376V  
>6212-30904| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTEMEKEGKISKIGPDNPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQNSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARTRGA
HTNDVKQLTEAVQKIVTESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006