<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6211 6211-30821 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IMV, I84V, L90M V11I, L33I L10I, I13V, A22V, E35D, M36I, N37D, D60DE, I62V, L63P, A71V, I72IT  
>6211-30821| codons 1-99
PQITLWQRPIITVKIGGQLKEVLLDTGADDTVIEDIDLPGRWKPKLIGGIGGFVKVRQYE
QVPIEICGHKVTGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       V60VI, V118I, K122KE, I135T, G196GE, Q197K, E203ED, H208Y, R211K, E224ED, V245K, L246LM, S251N, A272P, K281KR, E297R, I329V  
>6211-30821| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEKHRTKIDELRQYLWKWGFYTPDKKHQKDPPFLWMGYELHPDKWT
VQPIKMPEKDNWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006