Isolate Data
Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
503-42 | 503-42W12 | U.S. | 1996 | HIV1 | B | Plasma | None |
Treatment History
Order | Regimen | Weeks |
1 | NFV | 12 |
Protease Sequence
PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
D30N | L10I, I13V, I15V, I62V, L63I, A71T, T74A, I93L | I64P |
>503-42W12| codons 1-99 PQITLWQRPIVTVKVGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD QVIPEICGHKTIGAVLVGPTPVNIIGRNLLTQLGCTLNF |
References
Author | Title | Citation |
Patick, AK | Genotypic and phenotypic characterization of human immunodeficiency virus type 1 variants isolated from patients treated with the protease inhibitor nelfinavir. | AAC, 1998 |
Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |