<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6207 6207-30715 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R D67G, T215TI, K219Q K101E, G190S   K20R, V35M, T39A, E40D, V60VI, S68G, D123E, E138A, K173E, V179I, G196E, D237DN, A272P, K277R, A288AT, I293V, P294A, E297R, A360T, T386I, K390R, I393M Y232YH
>6207-30715| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICADMEKEGKISKIGPENPYNTPI
FAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIII
YQYMDDLYVSSDLEIEQHRTKIEELRQHLLRWGFITPDQKHQKEPPFLWMGHELHPNKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKTLTEVVALTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPMQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, L90M L33F, G73S, L89V E34EQ, N37NI, L63P, H69K, A71LV, I93M R57KN
>6207-30715| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTIFQEMILPGRWKPKMVGGIGGFMKVNQYD
QIPIEICGKKVISTVLVGPTPVNIIGRNVMTQMGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006