<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6203 6203-30729 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L24I L10V, E35D, M36MI, N37S, L63P, A71T  
>6203-30729| codons 1-99
PQITLWQRPVVTIKIGGQLKEALIDTGADDTVLEDISLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DGNS, K70R, L74LI, T215F K219Q K103KN   K20R, A33G, V60I, S68SG, D123E, I135T, K166R, T200I, R211RK, D218E, A272P, K277R, E297K, S322T, A360V, A376S  
>6203-30729| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKGLVEICTELEKEGKISKIGPENPYNTPI
FAIKKKSGTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGV
HTNDVKQLTEAVQKISTESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006