<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6202 6202-30729 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82C, L90M G73S L10V, I13V, I15V, L19I, K20T, I62V, L63P, A71T  
>6202-30729| codons 1-99
PQITLWQRPVVTVKVGGQITEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKTISTVLVGPTPCNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K20R, K43N, V60I, K64R, K102M, V118I, K122E, D123N, I135T, A272P, I293V, E297A, A360AITV, T369TAIV, T386TI, K390KR, A400T  
>6202-30729| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPI
FAIRKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKMKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGV
HTNDVKQLVEAVQKIATESIVIWGKIPKFRLPIQKETWET

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006