<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6193 6193-30724 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MIL, I54IV, V82VA, I84IV L10LFI, L24LI T12P, K20KM, R41K, L63P, I64V, H69R, A71AT, T74S, I93L  
>6193-30724| codons 1-99
PQITLWQRPIVPIKIGGQLMEALIDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPVEICGRKTIGSVLVGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y V75VI K103N   V60I, K82R, K122P, D123DE, I135T, I142T, T200TA, V245T, A272P, A288S, I293V, K347R, M357T, T386TAIV, A400AT Q197EV, A376AFSV
>6193-30724| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLIDFRELNRRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGVHRAKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFRNLKTGKYARTRGA
HTNDVKQLTEAVQKIVTESIVIWGKVPKFKLPIQKETWET

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006