<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6188 6188-30723 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_CT, L210W, T215Y A62AV, D67S K103N K238T V35T, K43Q, V118I, D123E, I135T, T139LM, S162CY, R211RK, F227FY, L228H, Q242QH, V245E, A272P, K281R, P294S, E297K, S322A, I329IV, E344D, R358K, A376AS, T386I, K390R, E399D P140PT
>6188-30723| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEQEGKISKIGPENPYNTPV
FVIKKKSSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNEMTGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPYHWMGYELHPDTWT
VHPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVISLTKEAE
LELAENREILKEPVHGVYYDPAKDLIAEVQKQGQGQWTYQIYQDPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKISTESIVIWGKIPKFRLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47IV, I54M, I84V, L90M V11VI, L33F, G73S, L89V L10V, K14R, R41K, K45KR, I62V, L63P, K70KR, A71V, T74S, V77I  
>6188-30723| codons 1-99
PQITLWQRPVITIRIGGQLKEALLDTGADDTVFEEMNLPGKWKPRMVGGIGGFMKVRQYD
QVPIEICGHRVISSVLIGPTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006