<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6166 6166-30729 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M V11VI, L33I, G73GS, N83D, L89V L10I, I13V, L19LV, K20R, A22V, E35D, M36I, N37E, I62IV, L63P, A71AITV, Q92QK  
>6166-30729| codons 1-99
PQITLWQRPIITVKIGGQVREVLLDTGADDTVIEDIELPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVISTVLVGPTPVDVIGRNVMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y   K101PQ, K103N   V35K, T39A, K43N, V118I, K122E, I142V, E203K, Q207E, R211K, L228N, A288S, I293IV, I326IV, Q334D, M357T, A360I  
>6166-30729| codons 1-398
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICAELENEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIKELREHLWKWGFYTPDKKHQKEPPFNWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGDGQWTYQIYQEPFKNLKTGKYARTRGI
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETW

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006