<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6159 6159-30710 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_CS, M184V D67A   A98G K20KQR, K49R, R83K, K122E, K173KLMQ, D177N, F214L, A272P, K281R, I293V, E297K, D324DE, G359S, A371V  
>6159-30710| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKASSKWRKLVDFRELNKKTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPNIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10LI, K20I, I64V, A71V  
>6159-30710| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKVISTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006