<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6157 6157-30704 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, Q151M A62V, K70KT, V75I, F116Y Y181C, G190A E138K I2V, P4T, S68G, T69TI, V118I, D121H, K122E, I135V, S162C, R172RK, D177E, V179GS, T200TA, E203D, Q207A, F214L, H221Y, L228R, V245I, A272P, T286A, I293V, I326V, Q334L, T386I  
>6157-30704| codons 1-400
PVSTIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKRKDGITWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSIPL
HEDFRKYTAFTIPSVNNKTPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFKKQNPEISI
CQYMDDLYVASDLEIGQHRAKIDELRAHLLRWGLTTPDKKYQKEPPFRWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48A, I54V, V82A, I84V, L90M L33F, Q58E, G73GS, L89LV T4S, L10I, K20R, E35D, M36L, R57RK, I62V, L63P, A71V, I72ILM, Q92K  
>6157-30704| codons 1-99
PQISLWQRPIVTIKIGGQLREALLDTGADDTVFEDLNLPGRWKPKMIAGIGGFVKVKEYD
QVPIEICGHKVMSTVLVGPTPANVIGRNVMTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006