<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6151 6151-30910 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82T, I84V Q58E L10I, L19I, K20R, M36I, N37D, I62V, L63P, I64V, I66F, A71V  
>6151-30910| codons 1-99
PQITLWQRPIVTIKIGGQIREALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFVKVREYD
QVPVEFCGHKVIGTVVVGPTPTNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y A62V, D67G, K219N     K22R, K43KR, E44D, S68G, V118I, D123E, I135T, S162SR, R211K, V245K, K277R, E291ED, V317A, Q334L, G359S, T386I, K390R  
>6151-30910| codons 1-399
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALVEICTELERDGKISKIGPENPYNTPV
FVIKKKGGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQRSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTDVIPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006