<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6150 6150-30826 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54ST, V82A, I84V L33F, K43T, Q58QE L10I, T12S, I13V, K14R, L19T, D60E, Q61E, L63P, H69HY, A71V, V77I, I93L  
>6150-30826| codons 1-99
PQITLWQRPIVSVRIGGQTKEALLDTGADDTVFEEMNLPGRWTPKIIVGIGGFTKVREYE
EIPIEICGYKVIGTVLIGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67~, K70R, L74V, M184V A62V, T215I, K219E     K11KR, V35I, K43E, T69N, A98S, K122KE, D123E, I135V, S162A, V179VI, R211K, L228H, A272P, K275R, K277R, T286A, P313T, V314I, M357T, T369V, T386TI, K390R  
>6150-30826| codons 1-399
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALIEICTEMEEEGKISKIGPENPYNTPV
FVIKKK~SNRWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFITPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKETIHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLVEAVQKIATESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006