<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6106 6106-30618 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I84V, L90M G73GA, T74TP L10V, I13V, K20M, L33V, N37D, L63P, H69K  
>6106-30618| codons 1-99
PQITLWQRPVVTVKIGGQLMEALLDTGADDTIVEEMDLPGRWKPKIVGGIGGFIKVRQYD
QIPIEICGKKAIAPVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103N Y318F E6D, V60VI, K122KE, I135T, K166R, G196E, R211K, A272P, K277R, E297R, R356K, M357V, A360T  
>6106-30618| codons 1-399
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTREAE
LELAENREILKEPVHGVFYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKVRGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006