<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6105 6105-30613 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54T, V82A, L90LM L24LI, L33F, K43T L10IV, E35D, M36L, N37D, Q61N, L63P, A71V, T74S, V77I, L89I, T91S, I93L  
>6105-30613| codons 1-99
PQITLWQRPVVTIKIGGQLKEALIDTGADDTVFEDLDLPGRWTPKLIVGIGGFTKVRQYD
NIPIEICGHKVIGSVLIGPTPANIIGRNIMSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69G_SG, L74V, L210W, T215Y   K103N   P4S, V118I, D123E, I135V, I142V, S162C, R172K, E203D, R211K, A272P, K281KR, T286A, E297KR, S322T, I329V, Q334E, M357MK, A371V, K390R, K395R, E396D, E399D  
>6105-30613| codons 1-399
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSGKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFKKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPTKDLIAEVQKQGEGQWTYQIYQEPFKNLKTGKYARKRGA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQRDTWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006