<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6089 6089-30619 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L33F L10I, T12P, K14R, E35D, M36I, R41K, R57RK, I62IV, L63P, I64IV, I93L  
>6089-30619| codons 1-99
PQITLWQRPIVPIRIGGQLKEALIDTGADDTVFEDINLPGKWKPKLIGGIGGFVKVKQYD
QVPVEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       V60I, V118I, I135T, E203K, Q207E, H208Y, R211K, K223Q, K277R, A288S, I293V, I326V, G333E, M357I, V365I, T386I, K390R  
>6089-30619| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQEQGQWTYQIYQEPFKNLKTGKYARIRGA
HTNDIKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006