<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6088 6088-30603 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, D67N, Q151M A62V, V75I, F116Y, T215V, K219E G190A K238T P4T, T39A, S68K, R83K, V90I, K101Q, K122E, R172K, T200A, V245K, V276T, K281R, E297K, D324E, Q334K, M357T, A371V, A376T, T377L, K390R, A400S  
>6088-30603| codons 1-400
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FVIKRKNKTKWRKLIDFRELNKKTQDFWEIQLGIPHPAGLQKKKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPDIVI
YQYMDDLYVASDLEIGQHRAKIEELRQHLLRWGFVTPDEKHQKEPPFLWMGYELHPDTWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKTKQLCRLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGKGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEVVQKITLESIVIWGKTPKFRLPIQKETWES

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82F, I84V, L90M L23I, L33F, G48E, Q58E L10I, I13V, E34K, N37T, I62V, L63P, V77I, L89M  
>6088-30603| codons 1-99
PQITLWQRPIVTVKIGGQLKEAILDTGADDTVFKEMTLPGRWKPKIIEGIGGFVKVREYD
QVPIEICGHKAIGTVVIGPTPFNVIGRNMMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006