<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6085 6085-30526 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74LI, L210W, T215Y D67G, K219Q K103N   S68G, V90VI, V106I, V118I, K122E, D123DN, I135T, Q197E, T200A, E203D, Q207E, D218E, Q242QH, V245K, A272P, I293V, I329IV, Q334S, M357S, A360V, A376T, T377M, I382IL, T386A  
>6085-30526| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKGGTRWRKIVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSITVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGEHRAKIDELREHLWRWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VHPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGSGQWTYQIYQEPFKNLKTGKYARSRGV
HTNDVKQLTEAVQKITMESIVLWGKAPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82C, L90M F53L, G73S L10I, I13V, I15V, K20T, E34EQ, M36I, N37ND, Q61QE, I62V, L63P, A71V, C95L  
>6085-30526| codons 1-99
PQITLWQRPIVTVKVGGQLTEALLDTGADDTVLQEIDLPGRWKPKMIMGIGGLVKVRQYD
EVPIEICGHKVISTVLVGPTPCNIIGRNLMTQIGLTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006