<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6073 6073-40108 Italy 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, L90M V32M, L33F, K43T, G73S L10V, E35ED, M36L, D60E, I62V, L63P, I64L, A71V, I93L E34HQ
>6073-40108| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTMFQDLNLPGRWTPKIVGGIGGFVKVRQYE
QVPLEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, L210W, T215Y K219E   A98G T27S, V35I, E40F, K43E, S68G, K102KR, V118I, K122E, K173E, L228H, K249Q, E297K, F346Y, M357T, S379G, T386I, K390R  
>6073-40108| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKRKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEQDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATEGIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006