<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6070 6070-30926 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, I84V, L90M L10F, V11I, L33F, Q58E, G73S I15V, K20T, M36ML, N37ND, D60E, I62V, L63P, A71V, I72L, V77VI, I85V, I93IL  
>6070-30926| codons 1-99
PQITLWQRPFITIKVGGQLTEALLDTGADDTVFEELDLPGRWKPKIIGGIGGFVKVREYE
QVPIEICGHKVLSTVLIGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       T39A, K43Q, K122E, I142T, T200A, R211K, L228H, A272P, K277R, I293V, P294T, E297Q, F346Y, A376V, S379C, T386A, K388R, E399D  
>6070-30926| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVTLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYARMRGA
HTNDVKQLTEAVQKIVTECIVIWGKAPRFKLPIQKETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006