<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6068 6068-30919 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L10F I15IV, N37D, R41K, K55R, D60E, I62V, L63P, A71V, I93L  
>6068-30919| codons 1-99
PQITLWQRPFVTIKVGGQLKEALLDTGADDTVLEEMDLPGKWKPKIIGGIGGFVRVRQYE
QVPIEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y       V35VI, R83K, V118VI, G196E, Q207E, R211K, V245L, A272P, I293IV, E297K, M357T, A376V, T386A, K390R, T397I  
>6068-30919| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIVTESIVIWGKAPKFRLPIQKEIWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006