<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6066 6066-30829 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L10F, L33I, Q58E I13V, K20R, M36I, N37T, R41K, I62V, L63T, I64V, T74S  
>6066-30829| codons 1-99
PQITLWQRPFVTVKIGGQLREALLDTGADDTVIEEITLPGKWKPKLIGGIGGFVKVREYD
QVTVEICGHKAIGSVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M V75I, F77L, F116Y K103N   T7P, K49R, S68G, R83K, W88WG, G196K, T200I, A272P, L283I, I293V, E297A, Q334N, V372L, A376T, T386A  
>6066-30829| codons 1-399
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKRKDGTRWRKLIDLRELNKKTQDFGEVQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIKQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEALQKITTESIVIWGKAPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006