<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-6052 6052-30530 Italy 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GV, I54IV, V82VA, L90M L33LF, K43T, N88D L10I, I15V, L19I, K20R, E34Q, E35D, M36I, N37D, R57K, Q61QH, I62V, L63P, I66IF, A71V, I72IT, I85IV  
>6052-30530| codons 1-99
PQITLWQRPIVTIKVGGQIREALLDTGADDTVFQDIDLPGRWTPKMIVGIGGFVKVKQYD
HVPIEFCGHKVTGTVLVGPTPANIVGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74I, M184V, L210W, T215Y D67H, V75S, K219D K101E, Y181C, G190A   K20KR, V35I, T39A, K43KQ, S68N, T69N, D123E, S162F, E203K, Q207E, R211K, D218E, L228H, D250E, A272P, I293IV, T296S, E297K, V317A, I329L, G333E, K350KR, R356K, M357R, G359S, A360T, T386I, E396D, E399D  
>6052-30530| codons 2-399
ISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEQEGKISKIGPENPYNTPVF
AIKKKHNNRWRKISDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLD
KEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRKQNPDIVIC
QYVDDLYVASDLEIGQHRTKIKELREHLWKWGFYTPEDKHQKEPPFHWMGYELHPDKWTV
QPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLSKEAEL
ELAENREILKEPVHGAYYDPSKDLIAELQKQEQGQWTYQIYQEPFKNLRTGKYAKRRSTH
TNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKDTWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006